CRF, Human, Rat

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.
Catalog No.5991166
Product CategoryPeptide
Sequence H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
CAS No. 86784-80-7
Mol. Formula C208H344N60O63S2
Mol. Weight 4575.5
Purity > 95%
MOQ 1 mg
Storage/Stability -20°C/1 year
Shipping Gel Packs

Available Size & Price Options

Select Qty

DescriptionSizeQuantity
No Product in Quote List.